PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009544P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 265aa    MW: 29257.6 Da    PI: 6.4943
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009544P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.62.5e-371468761
          zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++s
  MELO3C009544P1 14 NCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRS 68
                    8***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-27167IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6771367IPR003851Zinc finger, Dof-type
PfamPF027011.5E-311367IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MERGWKPMVE ISPNCPRCGS SNTKFCYYNN YSLTQPRYFC KGCRRYWTKG GSLRNVPVGG  60
GCRKNRRSPK PLTLTPSPSN PKLHHTNDSD YQRHHCDLSG SDVSPTIDLA VVYANFVNQK  120
PDTRETIPTT NTTSNAAGHF PVSGESGVVG CGNFCEFSMQ ECGLGASDYQ VGGGCFGLEE  180
SNNNNENQVD NIEVAARELQ LPPLPGEDVV EAWGNSMIMV NNHHRLQPTR VEMFEDPNLL  240
SGNWSPIDLS NYDTFSKGLT NMHI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443597.10.0PREDICTED: dof zinc finger protein DOF3.5
TrEMBLA0A0A0LGT71e-177A0A0A0LGT7_CUCSA; Uncharacterized protein
STRINGGLYMA10G10142.18e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.19e-48Dof family protein